Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCK Peptide - C-terminal region

HCK Peptide - C-terminal region

Product Specifications

Product Name Alternative

JTK9, p59Hck, p61Hck

UniProt

P08631

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HCK Rabbit Polyclonal Antibody (orb584947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165602

Preservative

Lyophilized powder

AA Sequence

LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filamin B/FLNB Antibody Picoband (monoclonal, 11E2D2)
orb1882171 100 µg

Filamin B/FLNB Antibody Picoband (monoclonal, 11E2D2)

Sign In for Pricing
View Details
VacA (Vacuolating Cytotoxin A) Rabbit ELISA Kit
I1802 96 Tests

VacA (Vacuolating Cytotoxin A) Rabbit ELISA Kit

Sign In for Pricing
View Details
NRCAM (NRCAM Protein EMBL AAH98401.1, Neuronal Cell Adhesion Molecule)
487247 100 µL

NRCAM (NRCAM Protein EMBL AAH98401.1, Neuronal Cell Adhesion Molecule)

Sign In for Pricing
View Details
CMKLR1 Antibody - C-terminal region : Biotin (AVARP07056_P050-Biotin)
AVARP07056_P050-Biotin 100 µL

CMKLR1 Antibody - C-terminal region : Biotin (AVARP07056_P050-Biotin)

Sign In for Pricing
View Details
Bovine Casein Alpha (CSN1) ELISA Kit DIY Materials
MBS2089403-01 5x 96 Tests

Bovine Casein Alpha (CSN1) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Bovine Casein Alpha (CSN1) ELISA Kit DIY Materials
MBS2089403-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Bovine Casein Alpha (CSN1) ELISA Kit DIY Materials

Sign In for Pricing
View Details