Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL16 Peptide - C-terminal region

IL16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ16806, FLJ42735, FLJ44234, LCF, NIL16, PRIL16, prIL-16

UniProt

Q14005

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL16 Rabbit Polyclonal Antibody (orb584964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004504

Preservative

Lyophilized powder

AA Sequence

EILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLBP Recombinant Rabbit monoclonal Antibody
HA751370 100 µL

BLBP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1,3-Diethyl-5-nitroso-6-aminouracil
TRC-D444650-250MG 250 mg

1,3-Diethyl-5-nitroso-6-aminouracil

Sign In for Pricing
View Details
GPNMB Human Gene Knockout Kit (CRISPR)
KN207615BN 1 Kit

GPNMB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BACE1 (NM_012104) Human Over-expression Lysate
LC402147 20 µg

BACE1 (NM_012104) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human ECH1 Protein
PKSH033275-01 10 µg

Recombinant Human ECH1 Protein

Sign In for Pricing
View Details
Recombinant Human ECH1 Protein
PKSH033275-02 50 µg

Recombinant Human ECH1 Protein

Sign In for Pricing
View Details