Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL16 Peptide - C-terminal region

IL16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ16806, FLJ42735, FLJ44234, LCF, NIL16, PRIL16, prIL-16

UniProt

Q14005

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL16 Rabbit Polyclonal Antibody (orb584964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004504

Preservative

Lyophilized powder

AA Sequence

EILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiopoietin-2 Antibody
KC-2990-01 50 μL

Angiopoietin-2 Antibody

Sign In for Pricing
View Details
Angiopoietin-2 Antibody
KC-2990-02 100 µL

Angiopoietin-2 Antibody

Sign In for Pricing
View Details
Angiopoietin-2 Antibody
KC-2990-03 1 mL

Angiopoietin-2 Antibody

Sign In for Pricing
View Details
Storage Box
R1020-O 5 Units/Pack

Storage Box

Sign In for Pricing
View Details
Fasudil Monohydrochloride Salt
TRC-F150018-500MG 500 mg

Fasudil Monohydrochloride Salt

Sign In for Pricing
View Details
Zbtb2 Mouse Gene Knockout Kit (CRISPR)
KN519597 1 Kit

Zbtb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details