Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABI2 Peptide - N-terminal region

ABI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ABI-2, ABI2B, AIP-1, AblBP3, SSH3BP2, argBPIA, argBPIB

UniProt

Q9NYB9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABI2 Rabbit Polyclonal Antibody (orb585020) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005750

Preservative

Lyophilized powder

AA Sequence

MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25C Rabbit Polyclonal Antibody
AP06044PU-N 100 µg

CDC25C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS801815 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
RPLP0 (NM_001002) Human Over-expression Lysate
LC424313 20 µg

RPLP0 (NM_001002) Human Over-expression Lysate

Sign In for Pricing
View Details
Fenbufen
TRC-F247200-10MG 10 mg

Fenbufen

Sign In for Pricing
View Details
HIP1R Rabbit Polyclonal Antibody
TA361113 100 µL

HIP1R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYP8B1 Rabbit Polyclonal Antibody
TA372942 100 µL

CYP8B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details