Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABI2 Peptide - N-terminal region

ABI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ABI-2, ABI2B, AIP-1, AblBP3, SSH3BP2, argBPIA, argBPIB

UniProt

Q9NYB9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABI2 Rabbit Polyclonal Antibody (orb585020) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005750

Preservative

Lyophilized powder

AA Sequence

MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIP3 (RIPK3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]
TA803101AM 100 µL

RIP3 (RIPK3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]

Sign In for Pricing
View Details
SynCAM (CADM1) (NM_001301044) Human Tagged ORF Clone
RG238313 10 µg

SynCAM (CADM1) (NM_001301044) Human Tagged ORF Clone

Sign In for Pricing
View Details
TNFRSF21 Antibody (Biotin)
KB-23324-01 50 μL

TNFRSF21 Antibody (Biotin)

Sign In for Pricing
View Details
TNFRSF21 Antibody (Biotin)
KB-23324-02 100 µL

TNFRSF21 Antibody (Biotin)

Sign In for Pricing
View Details
TNFRSF21 Antibody (Biotin)
KB-23324-03 1 mL

TNFRSF21 Antibody (Biotin)

Sign In for Pricing
View Details
2-Acetylcyclohexanone
TRC-A172105-50G 50 g

2-Acetylcyclohexanone

Sign In for Pricing
View Details