Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRK6 Peptide - C-terminal region

GRK6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ32135, GPRK6

UniProt

Q96AD6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRK6 Rabbit Polyclonal Antibody (orb585030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002073

Preservative

Lyophilized powder

AA Sequence

LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM149 (IGFLR1) Human Gene Knockout Kit (CRISPR)
KN414021 1 Kit

TMEM149 (IGFLR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Purinergic Receptor P2Y, G Protein Coupled 1 (P2RY1) ELISA Kit
abx257925 96 Well

Human Purinergic Receptor P2Y, G Protein Coupled 1 (P2RY1) ELISA Kit

Sign In for Pricing
View Details
(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous
FA10819-01 10 g

(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous

Sign In for Pricing
View Details
(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous
FA10819-02 25 g

(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous

Sign In for Pricing
View Details
(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous
FA10819-03 50 g

(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous

Sign In for Pricing
View Details
(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous
FA10819-04 100 g

(R) -3-Amino-1- (3- (trifluoromethyl) -5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7 (8H) -yl) -4- (2,4,5-trifluorophenyl) butan-1-one phosphate anhydrous

Sign In for Pricing
View Details