Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRK6 Peptide - C-terminal region

GRK6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ32135, GPRK6

UniProt

Q96AD6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRK6 Rabbit Polyclonal Antibody (orb585030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002073

Preservative

Lyophilized powder

AA Sequence

LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-RUNX1 (12.Ser 249) : m-IgG1 BP-HRP Bundle
sc-542686 1 Kit

P-RUNX1 (12.Ser 249) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Igsf9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6617708 1.0 µg DNA

Igsf9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM200A Antibody [Janelia Fluor 549]
NBP3-05968JF549 0.1 mL

Rabbit Polyclonal FAM200A Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
RPE65 Rabbit pAb, AP conjugated
orb2870987 100 µL

RPE65 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
TBC1D2B Protein Vector (Rat) (pPM-C-HA)
PV309920 500 ng

TBC1D2B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ADAL ELISA Kit (Mouse) (OKEH05040)
OKEH05040 96 Well

ADAL ELISA Kit (Mouse) (OKEH05040)

Sign In for Pricing
View Details