Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMMECR1 Peptide - C-terminal region

AMMECR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMMERC1

UniProt

Q9Y4X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMMECR1 Rabbit Polyclonal Antibody (orb585315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020751

Preservative

Lyophilized powder

AA Sequence

DHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFAIP3 Recombinant Rabbit monoclonal Antibody
HA750253 100 µL

TNFAIP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
FMO5 Polyclonal Antibody
E-AB-65553-01 60 µL

FMO5 Polyclonal Antibody

Sign In for Pricing
View Details
FMO5 Polyclonal Antibody
E-AB-65553-02 120 µL

FMO5 Polyclonal Antibody

Sign In for Pricing
View Details
FMO5 Polyclonal Antibody
E-AB-65553-03 200 µL

FMO5 Polyclonal Antibody

Sign In for Pricing
View Details
Nkx2.2 (NKX2-2) Mouse Monoclonal Antibody [Clone ID: 3E4]
AM06771PU-N 100 µg

Nkx2.2 (NKX2-2) Mouse Monoclonal Antibody [Clone ID: 3E4]

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), CF594 conjugate, 0.1mg/mL
BNC941730-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details