Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMMECR1 Peptide - C-terminal region

AMMECR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMMERC1

UniProt

Q9Y4X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMMECR1 Rabbit Polyclonal Antibody (orb585315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020751

Preservative

Lyophilized powder

AA Sequence

DHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM90A14P (NM_001164452) Human Over-expression Lysate
LY431411 100 µg

FAM90A14P (NM_001164452) Human Over-expression Lysate

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF740 conjugate, 0.1mg/mL
BNC740280-500 1x 500 µL

Glycophorin A / CD235a (GYPA/280), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26 + BA17), CF405S conjugate, 0.1mg/mL
BNC040753-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26 + BA17), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM71 (409-419) Goat Polyclonal Antibody
AP23732PU-N 100 µg

TRIM71 (409-419) Goat Polyclonal Antibody

Sign In for Pricing
View Details
ACTBL2 (NM_001017992) Human Over-expression Lysate
LY422231 100 µg

ACTBL2 (NM_001017992) Human Over-expression Lysate

Sign In for Pricing
View Details
Syntaxin 16 (STX16) (NM_001001433) Human Over-expression Lysate
LY425029 100 µg

Syntaxin 16 (STX16) (NM_001001433) Human Over-expression Lysate

Sign In for Pricing
View Details