ADCK2 Peptide - middle region
ADCK2 Peptide - middle region
Product Specifications
Product Name Alternative
AARF, MGC20727
UniProt
Q7Z695
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADCK2 Rabbit Polyclonal Antibody (orb585542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_443085
Preservative
Lyophilized powder
AA Sequence
LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6168624-01 0.1 mL
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (APC)
Sign In for Pricing
View Details 
MBS6168624-02 5x 0.1 mL
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (APC)
Sign In for Pricing
View Details ![Rabbit Monoclonal p63/TP73L Antibody (ZR8) [DyLight 650]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP3-08776C 100 µL
Rabbit Monoclonal p63/TP73L Antibody (ZR8) [DyLight 650]
Sign In for Pricing
View Details bs-43588P-Biotin-01 20 µg
Recombinant human EPOR protein, C-His (HEK293), Biotin Conjugated
Sign In for Pricing
View Details bs-43588P-Biotin-02 100 µg
Recombinant human EPOR protein, C-His (HEK293), Biotin Conjugated
Sign In for Pricing
View Details bs-43588P-Biotin-03 500 µg
Recombinant human EPOR protein, C-His (HEK293), Biotin Conjugated
Sign In for Pricing
View Details