Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAGA Peptide - middle region

NAGA Peptide - middle region

Product Specifications

Product Name Alternative

D22S674, GALB

UniProt

P17050

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAGA Rabbit Polyclonal Antibody (orb585599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000253

Preservative

Lyophilized powder

AA Sequence

CFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHEB (C-Term) Rabbit pAb
MBS8551570-01 0.1 mL

RHEB (C-Term) Rabbit pAb

Sign In for Pricing
View Details
RHEB (C-Term) Rabbit pAb
MBS8551570-02 0.1 mL (AF405L)

RHEB (C-Term) Rabbit pAb

Sign In for Pricing
View Details
RHEB (C-Term) Rabbit pAb
MBS8551570-03 0.1 mL (AF405S)

RHEB (C-Term) Rabbit pAb

Sign In for Pricing
View Details
RHEB (C-Term) Rabbit pAb
MBS8551570-04 0.1 mL (AF610)

RHEB (C-Term) Rabbit pAb

Sign In for Pricing
View Details
RHEB (C-Term) Rabbit pAb
MBS8551570-05 0.1 mL (AF635)

RHEB (C-Term) Rabbit pAb

Sign In for Pricing
View Details
RHEB (C-Term) Rabbit pAb
MBS8551570-06 0.1 mL (APC)

RHEB (C-Term) Rabbit pAb

Sign In for Pricing
View Details