Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHF Peptide - middle region

SHF Peptide - middle region

Product Specifications

UniProt

E7EWB7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHF Rabbit Polyclonal Antibody (orb326466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAG64721

Preservative

Lyophilized powder

AA Sequence

QPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCIAD2 Rabbit pAb
MBS8549703-01 0.1 mL

OCIAD2 Rabbit pAb

Sign In for Pricing
View Details
OCIAD2 Rabbit pAb
MBS8549703-02 0.1 mL (AF405L)

OCIAD2 Rabbit pAb

Sign In for Pricing
View Details
OCIAD2 Rabbit pAb
MBS8549703-03 0.1 mL (AF405S)

OCIAD2 Rabbit pAb

Sign In for Pricing
View Details
OCIAD2 Rabbit pAb
MBS8549703-04 0.1 mL (AF610)

OCIAD2 Rabbit pAb

Sign In for Pricing
View Details
OCIAD2 Rabbit pAb
MBS8549703-05 0.1 mL (AF635)

OCIAD2 Rabbit pAb

Sign In for Pricing
View Details
OCIAD2 Rabbit pAb
MBS8549703-06 0.1 mL (APC)

OCIAD2 Rabbit pAb

Sign In for Pricing
View Details