Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAR1 Peptide - C-terminal region

BCAR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAS, CAS1, CASS1, CRKAS, FLJ12176, FLJ45059, P130Cas

UniProt

B3KWE2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCAR1 Rabbit Polyclonal Antibody (orb585612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164192

Preservative

Lyophilized powder

AA Sequence

YVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNK-105x155-B7610-0.2 AF Systems Consumables
710681 Box of 200 Label(s)

MNK-105x155-B7610-0.2 AF Systems Consumables

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-01 0.02 mg (E-Coli)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-02 0.02 mg (Yeast)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-03 0.1 mg (E-Coli)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-04 0.1 mg (Yeast)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-05 0.02 mg (Baculovirus)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details