BCAR1 Peptide - C-terminal region
BCAR1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CAS, CAS1, CASS1, CRKAS, FLJ12176, FLJ45059, P130Cas
UniProt
B3KWE2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BCAR1 Rabbit Polyclonal Antibody (orb585612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001164192
Preservative
Lyophilized powder
AA Sequence
YVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1074588-01 5 mg
Benzyl (1- (((S) -3-bromo-4,5-dihydroisoxazol-5-yl) (methyl) amino) -3- (4-hydroxyphenyl) -1-oxopropan-2-yl) carbamate
Sign In for Pricing
View Details OR1074588-02 10 mg
Benzyl (1- (((S) -3-bromo-4,5-dihydroisoxazol-5-yl) (methyl) amino) -3- (4-hydroxyphenyl) -1-oxopropan-2-yl) carbamate
Sign In for Pricing
View Details OR1074588-03 25 mg
Benzyl (1- (((S) -3-bromo-4,5-dihydroisoxazol-5-yl) (methyl) amino) -3- (4-hydroxyphenyl) -1-oxopropan-2-yl) carbamate
Sign In for Pricing
View Details OR1074588-04 50 mg
Benzyl (1- (((S) -3-bromo-4,5-dihydroisoxazol-5-yl) (methyl) amino) -3- (4-hydroxyphenyl) -1-oxopropan-2-yl) carbamate
Sign In for Pricing
View Details