NCF2 Peptide - C-terminal region
NCF2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ93058, NCF-2, NOXA2, P67-PHOX, P67PHOX
UniProt
P19878
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NCF2 Rabbit Polyclonal Antibody (orb585940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000424
Preservative
Lyophilized powder
AA Sequence
TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882341-500 1x 500 µL
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH033696-01 10 µg
Recombinant Human DPP4/DPPIV/CD26 Protein (Fc Tag)
Sign In for Pricing
View Details PKSH033696-02 50 µg
Recombinant Human DPP4/DPPIV/CD26 Protein (Fc Tag)
Sign In for Pricing
View Details 