Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCF2 Peptide - C-terminal region

NCF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ93058, NCF-2, NOXA2, P67-PHOX, P67PHOX

UniProt

P19878

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCF2 Rabbit Polyclonal Antibody (orb585940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000424

Preservative

Lyophilized powder

AA Sequence

TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC38A11 Human Gene Knockout Kit (CRISPR)
KN416362 1 Kit

SLC38A11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CYP39A1 activation kit by CRISPRa
GA109721 1 Kit

Human CYP39A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Hspb9 activation kit by CRISPRa
GA210229 1 Kit

Mouse Hspb9 activation kit by CRISPRa

Sign In for Pricing
View Details
4,8-Bis(4-fluoro-5-(heptan-3-ylthio)thiophen-2-yl)benzo[1,2-b:4,5-b']dithiophene
TRC-B785580-250MG 250 mg

4,8-Bis(4-fluoro-5-(heptan-3-ylthio)thiophen-2-yl)benzo[1,2-b:4,5-b']dithiophene

Sign In for Pricing
View Details
Pure Vicia villosa Lectin (Hairy Vetch) -VVA-
L-4601-5 5 mg

Pure Vicia villosa Lectin (Hairy Vetch) -VVA-

Sign In for Pricing
View Details