Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE7A Peptide - C-terminal region

PDE7A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HCP1, PDE7

UniProt

Q13946

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE7A Rabbit Polyclonal Antibody (orb585963) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229247

Preservative

Lyophilized powder

AA Sequence

DRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 2C8 (CYP2C8) Human ELISA Kit
C7732 96 Tests

Cytochrome P450 2C8 (CYP2C8) Human ELISA Kit

Sign In for Pricing
View Details
3-Oxo-2H,3H-[1,2,4]triazolo[4,3-a]pyridine-7-carboxylic acid
ITB36917-01 50 mg

3-Oxo-2H,3H-[1,2,4]triazolo[4,3-a]pyridine-7-carboxylic acid

Sign In for Pricing
View Details
3-Oxo-2H,3H-[1,2,4]triazolo[4,3-a]pyridine-7-carboxylic acid
ITB36917-02 0.5 g

3-Oxo-2H,3H-[1,2,4]triazolo[4,3-a]pyridine-7-carboxylic acid

Sign In for Pricing
View Details
Porcine Dihydropyrimidinase Like Protein 3 ELISA kit
GTR10389927 96 Well

Porcine Dihydropyrimidinase Like Protein 3 ELISA kit

Sign In for Pricing
View Details
Fst 3'UTR Lenti-reporter-Luc Vector
20993086 1.0 µg

Fst 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
STX4 antibody
70R-20625 50 ul

STX4 antibody

Sign In for Pricing
View Details