Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE7A Peptide - C-terminal region

PDE7A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HCP1, PDE7

UniProt

Q13946

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE7A Rabbit Polyclonal Antibody (orb585963) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229247

Preservative

Lyophilized powder

AA Sequence

DRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPATCH3 Rabbit Polyclonal Antibody (BF647)
orb2524180 100 µL

GPATCH3 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Prefoldin 5 shRNA (h) Lentiviral Particles
sc-40876-V 200 µL

Prefoldin 5 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Human Myelin Protein Zero Protein - (Dry Ice)
H00004359-P01-10ug 10 µg

Recombinant Human Myelin Protein Zero Protein - (Dry Ice)

Sign In for Pricing
View Details
MUC4 Rabbit Polyclonal Antibody (FITC)
orb14153 100 µL

MUC4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HPD Rabbit Polyclonal Antibody
orb627797-01 50 µg

HPD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HPD Rabbit Polyclonal Antibody
orb627797-02 100 µg

HPD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details