Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO2 Peptide - C-terminal region

IDO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

INDOL1

UniProt

F5H5G0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDO2 Rabbit Polyclonal Antibody (orb586055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919270

Preservative

Lyophilized powder

AA Sequence

LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-kB p65 (RELA) Human Gene Knockout Kit (CRISPR)
KN420780 1 Kit

NF-kB p65 (RELA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TMPRSS4 activation kit by CRISPRa
GA111204 1 Kit

Human TMPRSS4 activation kit by CRISPRa

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF568 conjugate, 0.1mg/mL
BNC682434-500 1x 500 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS801976 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Glypican 2 (GPC2) (N-term) Rabbit Polyclonal Antibody
AP51901PU-N 400 µL

Glypican 2 (GPC2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Epoxide hydrolase (EPHX1) Human Gene Knockout Kit (CRISPR)
KN400621 1 Kit

Epoxide hydrolase (EPHX1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details