Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO2 Peptide - C-terminal region

IDO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

INDOL1

UniProt

F5H5G0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDO2 Rabbit Polyclonal Antibody (orb586055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919270

Preservative

Lyophilized powder

AA Sequence

LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (DCS-72.F6), CF647 conjugate, 0.1mg/mL
BNC470771-100 1x 100 µL

P27 / KIP1 (DCS-72.F6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VGLUT2 Recombinant Chimeric Antibody Antibody
HA610285 100 µg

VGLUT2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Zalcitabine
TRC-Z140000-1G 1 g

Zalcitabine

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MASP1 (heavy chain, Cleaved-Arg448) Antibody
8L0238-AAT 50 µg

MASP1 (heavy chain, Cleaved-Arg448) Antibody

Sign In for Pricing
View Details
Recombinant UHRF1 Antibody
RC-6786-01 50 μL

Recombinant UHRF1 Antibody

Sign In for Pricing
View Details