Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDC3 Peptide - middle region

EDC3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21128, FLJ31777, LSM16, YJDC, YJEFN2

UniProt

Q96F86

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EDC3 Rabbit Polyclonal Antibody (orb331300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079359

Preservative

Lyophilized powder

AA Sequence

KKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDT

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Rabbit anti-Goat IgG (H+L) Secondary Antibody [PE/Cy5.5]
NBP1-74825PECY55 0.5 mL

Rabbit Polyclonal Rabbit anti-Goat IgG (H+L) Secondary Antibody [PE/Cy5.5]

Sign In for Pricing
View Details
LIMD2 (NM_030576) Human Untagged Clone
SC109913 10 µg

LIMD2 (NM_030576) Human Untagged Clone

Sign In for Pricing
View Details
IGF2BP2 Rabbit Monoclonal Antibody [KD Validation]
E51K2091 40 µL

IGF2BP2 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Glycerol anhydrous, from plants for cell biology
1413 mL500 500 mL

Glycerol anhydrous, from plants for cell biology

Sign In for Pricing
View Details
Chicken Talin 2 ELISA Kit
MBS085687 Inquire

Chicken Talin 2 ELISA Kit

Sign In for Pricing
View Details
PCMV-PDL1-3xFLAG-Neo Plasmid
PVT73939 2 µg

PCMV-PDL1-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details