Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDC3 Peptide - middle region

EDC3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21128, FLJ31777, LSM16, YJDC, YJEFN2

UniProt

Q96F86

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EDC3 Rabbit Polyclonal Antibody (orb331300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079359

Preservative

Lyophilized powder

AA Sequence

KKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDT

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC17A9 shRNA Plasmid (m)
sc-141874-SH 20 µg

SLC17A9 shRNA Plasmid (m)

Sign In for Pricing
View Details
Rat tet methylcytosine dioxygenase 1 (TET1) ELISA Kit
YP-W35107-01 48 Tests

Rat tet methylcytosine dioxygenase 1 (TET1) ELISA Kit

Sign In for Pricing
View Details
Rat tet methylcytosine dioxygenase 1 (TET1) ELISA Kit
YP-W35107-02 96 Tests

Rat tet methylcytosine dioxygenase 1 (TET1) ELISA Kit

Sign In for Pricing
View Details
Antibody against S. typhi, only
MBS478271-01 1 mg

Antibody against S. typhi, only

Sign In for Pricing
View Details
Antibody against S. typhi, only
MBS478271-02 2 mg

Antibody against S. typhi, only

Sign In for Pricing
View Details
Antibody against S. typhi, only
MBS478271-03 5 mg

Antibody against S. typhi, only

Sign In for Pricing
View Details