L2HGDH Peptide - middle region
L2HGDH Peptide - middle region
Product Specifications
Product Name Alternative
C14orf160, DURANIN, FLJ12618
UniProt
Q9H9P8
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with L2HGDH Rabbit Polyclonal Antibody (orb586122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079160
Preservative
Lyophilized powder
AA Sequence
GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
039135-ML750 100 µL
NRARP, ID (NRARP, Notch-regulated ankyrin repeat-containing protein) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
K7057206 1.0 µg DNA
Klf5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
ARP35712_T100-FITC 100 µL
SOX14 Antibody - middle region : FITC (ARP35712_T100-FITC)
Sign In for Pricing
View Details 
246910-Biotin 100 µL
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (Biotin)
Sign In for Pricing
View Details