Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3H Peptide - C-terminal region

APOBEC3H Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARP10

UniProt

B7TQM3

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC3H Rabbit Polyclonal Antibody (orb326520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861438

Preservative

Lyophilized powder

AA Sequence

SQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (GFR1195 + 31G7), CF405S conjugate, 0.1mg/mL
BNC041200-500 1x 500 µL

EGFR (GFR1195 + 31G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse TGFBR3 (C-6His)
MBS2569349-01 0.01 mg

Recombinant Mouse TGFBR3 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse TGFBR3 (C-6His)
MBS2569349-02 0.05 mg

Recombinant Mouse TGFBR3 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse TGFBR3 (C-6His)
MBS2569349-03 5x 0.05 mg

Recombinant Mouse TGFBR3 (C-6His)

Sign In for Pricing
View Details
HMGCL AAV siRNA Pooled Vector
23581161 1.0 µg

HMGCL AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit semaphorin-4D/SEMA4D/CD100 ELISA Kit
EIA07067Rb 1 Kit

Rabbit semaphorin-4D/SEMA4D/CD100 ELISA Kit

Sign In for Pricing
View Details