Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3H Peptide - C-terminal region

APOBEC3H Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARP10

UniProt

B7TQM3

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC3H Rabbit Polyclonal Antibody (orb326520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861438

Preservative

Lyophilized powder

AA Sequence

SQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Leu-Trp-Met-Arg-OH
H-3975.0250 250.0mg

H-Leu-Trp-Met-Arg-OH

Sign In for Pricing
View Details
Exodus 2 (CCL21) (NM_002989) Human Over-expression Lysate
LC401047 20 µg

Exodus 2 (CCL21) (NM_002989) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Salmonella yihY Protein (aa 1-290) (strain SL483)
VAng-Wyb0752-inquire Inquire

Recombinant Salmonella yihY Protein (aa 1-290) (strain SL483)

Sign In for Pricing
View Details
Rabbit Polyclonal Erythropoietin Antibody
NB110-60996 0.1 mg

Rabbit Polyclonal Erythropoietin Antibody

Sign In for Pricing
View Details
Rat Monoclonal TSPAN8/TM4SF3 Antibody (657909) [Janelia Fluor 525]
FAB6524JF525 0.1 mL

Rat Monoclonal TSPAN8/TM4SF3 Antibody (657909) [Janelia Fluor 525]

Sign In for Pricing
View Details
Junctophilin-2 Double Nickase Plasmid (m2)
sc-425599-NIC-2 20 µg

Junctophilin-2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details