Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRICKLE2 Peptide - C-terminal region

PRICKLE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686D143, DKFZp686H1748, DKFZp686M031

UniProt

Q7Z3G6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_942559

Preservative

Lyophilized powder

AA Sequence

IPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKNCIIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Disintegrin and Metalloproteinase domain-containing protein 20 (ADAM20) Human ELISA Kit
C9162 96 Tests

Disintegrin and Metalloproteinase domain-containing protein 20 (ADAM20) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Acorus americanus Chloroplast envelope membrane protein (cemA)
MBS7011271-01 0.02 mg

Recombinant Acorus americanus Chloroplast envelope membrane protein (cemA)

Sign In for Pricing
View Details
Recombinant Acorus americanus Chloroplast envelope membrane protein (cemA)
MBS7011271-02 0.1 mg

Recombinant Acorus americanus Chloroplast envelope membrane protein (cemA)

Sign In for Pricing
View Details
Recombinant Acorus americanus Chloroplast envelope membrane protein (cemA)
MBS7011271-03 5x 0.1 mg

Recombinant Acorus americanus Chloroplast envelope membrane protein (cemA)

Sign In for Pricing
View Details
Multiplex Assay Kit for Fibrinogen Gamma (FGg), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029301 96 Tests

Multiplex Assay Kit for Fibrinogen Gamma (FGg), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Nori® Porcine 2-Plex ELISA Kits-MMP2/MMP9
GR224147 96 Well

Nori® Porcine 2-Plex ELISA Kits-MMP2/MMP9

Sign In for Pricing
View Details