Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRICKLE2 Peptide - C-terminal region

PRICKLE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686D143, DKFZp686H1748, DKFZp686M031

UniProt

Q7Z3G6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_942559

Preservative

Lyophilized powder

AA Sequence

IPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKNCIIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC2 CytoSection
TS410263P5 25 Slides

EXOC2 CytoSection

Sign In for Pricing
View Details
Mouse Thiobarbituric Acid Reactive Substances (TBARS) ELISA Kit
EIA06995m 1 Kit

Mouse Thiobarbituric Acid Reactive Substances (TBARS) ELISA Kit

Sign In for Pricing
View Details
Isopropyl 2-ethylhexanoate
orb2664754-01 25 mg

Isopropyl 2-ethylhexanoate

Sign In for Pricing
View Details
Isopropyl 2-ethylhexanoate
orb2664754-02 50 mg

Isopropyl 2-ethylhexanoate

Sign In for Pricing
View Details
Isopropyl 2-ethylhexanoate
orb2664754-03 100 mg

Isopropyl 2-ethylhexanoate

Sign In for Pricing
View Details
MMD2 Antibody, Biotin conjugated
CSB-PA814229LD01HU-01 50 µg

MMD2 Antibody, Biotin conjugated

Sign In for Pricing
View Details