Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGFR Peptide - C-terminal region

PTGFR Peptide - C-terminal region

Product Specifications

Product Name Alternative

FP, MGC120498, MGC46203

UniProt

P43088

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGFR Rabbit Polyclonal Antibody (orb586157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000950

Preservative

Lyophilized powder

AA Sequence

RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 12 (SEPTIN12) Antibody (FITC)
abx308505-01 20 µg

Septin 12 (SEPTIN12) Antibody (FITC)

Sign In for Pricing
View Details
Septin 12 (SEPTIN12) Antibody (FITC)
abx308505-02 50 µg

Septin 12 (SEPTIN12) Antibody (FITC)

Sign In for Pricing
View Details
Septin 12 (SEPTIN12) Antibody (FITC)
abx308505-03 100 µg

Septin 12 (SEPTIN12) Antibody (FITC)

Sign In for Pricing
View Details
Septin 12 (SEPTIN12) Antibody (FITC)
abx308505-04 200 µg

Septin 12 (SEPTIN12) Antibody (FITC)

Sign In for Pricing
View Details
Septin 12 (SEPTIN12) Antibody (FITC)
abx308505-05 1 mg

Septin 12 (SEPTIN12) Antibody (FITC)

Sign In for Pricing
View Details
HKOCl-4m
MBS5785524 Inquire

HKOCl-4m

Sign In for Pricing
View Details