Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPC6 Peptide - N-terminal region

GPC6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126288, OMIMD1

UniProt

Q9Y625

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPC6 Rabbit Polyclonal Antibody (orb586165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005699

Preservative

Lyophilized powder

AA Sequence

AYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K8 (NM_005204) Human Over-expression Lysate
LC401593 20 µg

MAP3K8 (NM_005204) Human Over-expression Lysate

Sign In for Pricing
View Details
Col9a1 Mouse Gene Knockout Kit (CRISPR)
KN503654 1 Kit

Col9a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cd37 Mouse Gene Knockout Kit (CRISPR)
KN502911 1 Kit

Cd37 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,6-Dichloro-4-fluorophenylboronic acid
TRC-D475213-500MG 500 mg

2,6-Dichloro-4-fluorophenylboronic acid

Sign In for Pricing
View Details
25iP-NBOMe Hydrochloride
TRC-N291680-5MG 5 mg

25iP-NBOMe Hydrochloride

Sign In for Pricing
View Details
Human Complement C3 Recombinant Rabbit monoclonal Antibody
HA725141 100 µL

Human Complement C3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details