Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPC6 Peptide - N-terminal region

GPC6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126288, OMIMD1

UniProt

Q9Y625

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPC6 Rabbit Polyclonal Antibody (orb586165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005699

Preservative

Lyophilized powder

AA Sequence

AYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenidone
TRC-P297253-5G 5 g

Phenidone

Sign In for Pricing
View Details
FNIP1 Antibody: ATTO 488
SPC-718D-A488 100 µg

FNIP1 Antibody: ATTO 488

Sign In for Pricing
View Details
POLR3D Human Gene Knockout Kit (CRISPR)
KN402505 1 Kit

POLR3D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Artemin (ARTN) Mouse Monoclonal Antibody [Clone ID: 2D12]
AM33448PU-N 100 µg

Artemin (ARTN) Mouse Monoclonal Antibody [Clone ID: 2D12]

Sign In for Pricing
View Details
Maltose Microplate Assay Kit
RDSM235 100 Assays

Maltose Microplate Assay Kit

Sign In for Pricing
View Details
Rgs2 Mouse Gene Knockout Kit (CRISPR)
KN514736 1 Kit

Rgs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details