Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG3 Peptide - C-terminal region

NDRG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13556

UniProt

Q9UGV2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDRG3 Rabbit Polyclonal Antibody (orb586234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071922

Preservative

Lyophilized powder

AA Sequence

RLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA8L2 Antibody
23-073 100 µL

ANXA8L2 Antibody

Sign In for Pricing
View Details
Nucleobindin 2/NUCB2 Rabbit Polyclonal Antibody (Carrier-free)
orb3075335 100 µg

Nucleobindin 2/NUCB2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Comb 1 Prep 1 Marker 1mm thick
VS2011 1 Each

Comb 1 Prep 1 Marker 1mm thick

Sign In for Pricing
View Details
PABPC3 antibody
70R-19084 50 ul

PABPC3 antibody

Sign In for Pricing
View Details
LGTN sgRNA CRISPR Lentivector set (Human)
K1212301 3x 1.0 µg

LGTN sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
hsa-miR-4726-5p miRNA Agomir
MBS8312273-01 5 nmol

hsa-miR-4726-5p miRNA Agomir

Sign In for Pricing
View Details