Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG3 Peptide - C-terminal region

NDRG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13556

UniProt

Q9UGV2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDRG3 Rabbit Polyclonal Antibody (orb586234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071922

Preservative

Lyophilized powder

AA Sequence

RLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICOS / AILIM / CD278 Protein (His & hFc Tag)
600-146-L100 100 µg

ICOS / AILIM / CD278 Protein (His & hFc Tag)

Sign In for Pricing
View Details
alpha 1,2 Mannosidase IA (MAN1A1) Human Gene Knockout Kit (CRISPR)
KN413002 1 Kit

alpha 1,2 Mannosidase IA (MAN1A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)
MBS2003762-01 0.1 mL

Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)
MBS2003762-02 0.2 mL

Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)
MBS2003762-03 0.5 mL

Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)
MBS2003762-04 1 mL

Biotin-Linked Antibody to Chemokine C-X-C-Motif Ligand 15 (CXCL15)

Sign In for Pricing
View Details