Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLE1 Peptide - C-terminal region

NLE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10458, Nle

UniProt

Q9NVX2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NLE1 Rabbit Polyclonal Antibody (orb586236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060566

Preservative

Lyophilized powder

AA Sequence

DSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPKAPK2 Rabbit Monoclonal Antibody [Clone ID: 23GB2820]
TA424958 100 µL

MAPKAPK2 Rabbit Monoclonal Antibody [Clone ID: 23GB2820]

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF488A conjugate, 0.1mg/mL
BNC881857-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CASP1 Polyclonal Antibody
E-AB-18207-01 20 µL

CASP1 Polyclonal Antibody

Sign In for Pricing
View Details
CASP1 Polyclonal Antibody
E-AB-18207-02 60 µL

CASP1 Polyclonal Antibody

Sign In for Pricing
View Details
CASP1 Polyclonal Antibody
E-AB-18207-03 120 µL

CASP1 Polyclonal Antibody

Sign In for Pricing
View Details
CASP1 Polyclonal Antibody
E-AB-18207-04 200 µL

CASP1 Polyclonal Antibody

Sign In for Pricing
View Details