Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OST4 Peptide - C-terminal region

OST4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp586A0722

UniProt

P0C6T2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OST4 Rabbit Polyclonal Antibody (orb586322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128165

Preservative

Lyophilized powder

AA Sequence

MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJA3 Protein Lysate (Rat) with C-HA Tag
21535036 100 µg

GJA3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
RABL5 Protein Vector (Human) (pPM-C-HA)
PV034131 500 ng

RABL5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
COX7A2L Human shRNA Lentiviral Particle (Locus ID 9167)
TL319850V 500 µL Each

COX7A2L Human shRNA Lentiviral Particle (Locus ID 9167)

Sign In for Pricing
View Details
Human SPARCL1 (SPARC Like Protein 1) ELISA Kit
EKE60786 96 Tests

Human SPARCL1 (SPARC Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C14orf119, C14orf119 ELISA Kit
MBS9329975-01 48 Well

Human Uncharacterized protein C14orf119, C14orf119 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C14orf119, C14orf119 ELISA Kit
MBS9329975-02 96 Well

Human Uncharacterized protein C14orf119, C14orf119 ELISA Kit

Sign In for Pricing
View Details