RPL28 Peptide - N-terminal region
RPL28 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ43307
UniProt
E9PB24
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPL28 Rabbit Polyclonal Antibody (orb586327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129607
Preservative
Lyophilized powder
AA Sequence
SSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC050391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740096-100 1x 100 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details