Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS1R1 Peptide - middle region

TAS1R1 Peptide - middle region

Product Specifications

Product Name Alternative

GPR70, T1R1, TR1, gm148

UniProt

Q7RTX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS1R1 Rabbit Polyclonal Antibody (orb586335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619642

Preservative

Lyophilized powder

AA Sequence

QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ctsd activation kit by CRISPRa
GA200948 1 Kit

Mouse Ctsd activation kit by CRISPRa

Sign In for Pricing
View Details
Human SEC14L4 activation kit by CRISPRa
GA117183 1 Kit

Human SEC14L4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant RFC2 Antibody
RC-6881-01 50 μL

Recombinant RFC2 Antibody

Sign In for Pricing
View Details
Recombinant RFC2 Antibody
RC-6881-02 100 µL

Recombinant RFC2 Antibody

Sign In for Pricing
View Details
Recombinant RFC2 Antibody
RC-6881-03 1 mL

Recombinant RFC2 Antibody

Sign In for Pricing
View Details
L-Valyl-L-histidyl-L-leucyl-L-threonyl-L-prolyl-L-glutamic Acid Trifluoroacetate
TRC-V096270-25MG 25 mg

L-Valyl-L-histidyl-L-leucyl-L-threonyl-L-prolyl-L-glutamic Acid Trifluoroacetate

Sign In for Pricing
View Details