Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRTM3 Peptide - C-terminal region

LRRTM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC131810

UniProt

Q86VH5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRTM3 Rabbit Polyclonal Antibody (orb586387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_821079

Preservative

Lyophilized powder

AA Sequence

SLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGPCTYNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM87B Recombinant Protein Antigen
NBP1-94006PEP 0.1 mL

TMEM87B Recombinant Protein Antigen

Sign In for Pricing
View Details
PLAUR Rabbit Polyclonal Antibody (Cy3)
orb988219 100 µL

PLAUR Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Rat CDK16 shRNA Plasmid
abx986678-01 150 µg

Rat CDK16 shRNA Plasmid

Sign In for Pricing
View Details
Rat CDK16 shRNA Plasmid
abx986678-02 300 µg

Rat CDK16 shRNA Plasmid

Sign In for Pricing
View Details
Sgms1 (NM_001168525) Mouse Tagged ORF Clone
MG219071 10 µg

Sgms1 (NM_001168525) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NFX1 CRISPR/Cas9 KO Plasmid (m)
sc-428761 20 µg

NFX1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details