Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRTM3 Peptide - C-terminal region

LRRTM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC131810

UniProt

Q86VH5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRTM3 Rabbit Polyclonal Antibody (orb586387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_821079

Preservative

Lyophilized powder

AA Sequence

SLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGPCTYNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal PLRP1 Antibody
H00005407-B01P 0.05 mg

Mouse Polyclonal PLRP1 Antibody

Sign In for Pricing
View Details
NET1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6167R-BF680 100 µL

NET1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Polyclonal Phospho-C-Kit-Y936 Antibody
APR00470G 0.1 mg

Polyclonal Phospho-C-Kit-Y936 Antibody

Sign In for Pricing
View Details
hnRNP A2 / B1 Blocking Peptide
abx162501-01 1 mg

hnRNP A2 / B1 Blocking Peptide

Sign In for Pricing
View Details
hnRNP A2 / B1 Blocking Peptide
abx162501-02 5 mg

hnRNP A2 / B1 Blocking Peptide

Sign In for Pricing
View Details
Rabbit anti Bovine Superoxide dismutase
MBS573153-01 1 mg

Rabbit anti Bovine Superoxide dismutase

Sign In for Pricing
View Details