Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKS1B Peptide - C-terminal region

ANKS1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIDA, AIDA-1, ANKS2, EB-1, EB1, MGC26087, cajalin-2

UniProt

F8VZR9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKS1B Rabbit Polyclonal Antibody (orb586404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001190995

Preservative

Lyophilized powder

AA Sequence

ACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MAK16
P6587-01 50 µg

Recombinant Human MAK16

Sign In for Pricing
View Details
Recombinant Human MAK16
P6587-02 200 µg

Recombinant Human MAK16

Sign In for Pricing
View Details
Recombinant Human MAK16
P6587-03 1 mg

Recombinant Human MAK16

Sign In for Pricing
View Details
Rabbit Anti-Human TERF1 pAb
PA13928-01 50 μL

Rabbit Anti-Human TERF1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TERF1 pAb
PA13928-02 100 μL

Rabbit Anti-Human TERF1 pAb

Sign In for Pricing
View Details
Guinea pig Histone Deacetylase ELISA Kit
MBS728883-01 48 Well

Guinea pig Histone Deacetylase ELISA Kit

Sign In for Pricing
View Details