Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKS1B Peptide - C-terminal region

ANKS1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIDA, AIDA-1, ANKS2, EB-1, EB1, MGC26087, cajalin-2

UniProt

F8VZR9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKS1B Rabbit Polyclonal Antibody (orb586404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001190995

Preservative

Lyophilized powder

AA Sequence

ACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRP2 Peptide
DF7032-BP 1 mg

NRP2 Peptide

Sign In for Pricing
View Details
ATP6V0D2 Antibody - middle region : FITC (ARP55488_P050-FITC)
ARP55488_P050-FITC 100 µL

ATP6V0D2 Antibody - middle region : FITC (ARP55488_P050-FITC)

Sign In for Pricing
View Details
AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L) (PE)
MBS6273355-01 0.2 mL

AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L) (PE)

Sign In for Pricing
View Details
AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L) (PE)
MBS6273355-02 5x 0.2 mL

AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L) (PE)

Sign In for Pricing
View Details
Mouse anti-rabbit IgG-CFL 405
sc-516247 200 µg - 0.5 mL

Mouse anti-rabbit IgG-CFL 405

Sign In for Pricing
View Details
Nori® Zebrafish 14-3-3 ELISA Kit
GR206178 96 Well

Nori® Zebrafish 14-3-3 ELISA Kit

Sign In for Pricing
View Details