Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC42EP1 Peptide - N-terminal region

CDC42EP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BORG5, CEP1, MGC15316, MSE55

UniProt

Q00587

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC42EP1 Rabbit Polyclonal Antibody (orb586406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689449

Preservative

Lyophilized powder

AA Sequence

HTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora B (Proliferation Marker) (AURKB/3121R), CF640R conjugate, 0.1mg/mL
BNC403121-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/3121R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Acetyl-3-ethylpyrazine
BUP19118 1 mL

2-Acetyl-3-ethylpyrazine

Sign In for Pricing
View Details
MraY Antibody
orb822093 2 mg

MraY Antibody

Sign In for Pricing
View Details
Lids for microtiter plates - sterile (10 pouches x 5 Lids) 1 Box
62-503051 (10 pouches x 5 Lids) 1 Box

Lids for microtiter plates - sterile (10 pouches x 5 Lids) 1 Box

Sign In for Pricing
View Details
MTNR1A Protein Vector (Mouse) (pPM-C-His)
PV202885 500 ng

MTNR1A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human TrkC / NTRK3 Protein, Fc Tag (MALS verified)
TRC-H5256-100ug 100 µg

Human TrkC / NTRK3 Protein, Fc Tag (MALS verified)

Sign In for Pricing
View Details