Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMILIN3 Peptide - C-terminal region

EMILIN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf130, DKFZp434A2410, EMILIN5, dJ620E11.4

UniProt

Q9NT22

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMILIN3 Rabbit Polyclonal Antibody (orb586413) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443078

Preservative

Lyophilized powder

AA Sequence

QYSDAFLAANTSLDERERKVEAEVQAIQEQVSSQGSRLQAGHRQVLNLRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Japanese Encephalitis (JEV) antiserum
01-0007 250 µL

Rabbit anti-Japanese Encephalitis (JEV) antiserum

Sign In for Pricing
View Details
LentimiRa-hsa-miR-135a-3p Vector
mh41603 500 ng

LentimiRa-hsa-miR-135a-3p Vector

Sign In for Pricing
View Details
RINT-1 Double Nickase Plasmid (h2)
sc-407428-NIC-2 20 µg

RINT-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Anti-DPH1 Antibody Picoband® PE Conjugated
A08287-1-PE 100 µg/Vial

Anti-DPH1 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Universal stress protein E (uspE)
MBS1287530-01 0.02 mg (E-Coli)

Recombinant Salmonella typhimurium Universal stress protein E (uspE)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Universal stress protein E (uspE)
MBS1287530-02 0.02 mg (Yeast)

Recombinant Salmonella typhimurium Universal stress protein E (uspE)

Sign In for Pricing
View Details