Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMILIN3 Peptide - C-terminal region

EMILIN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf130, DKFZp434A2410, EMILIN5, dJ620E11.4

UniProt

Q9NT22

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMILIN3 Rabbit Polyclonal Antibody (orb586413) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443078

Preservative

Lyophilized powder

AA Sequence

QYSDAFLAANTSLDERERKVEAEVQAIQEQVSSQGSRLQAGHRQVLNLRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNA4 CRISPRa sgRNA lentivector (set of three targets)(Human)
19017121 3x 1.0µg DNA

EFNA4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse Monoclonal Chikungunya Virus Antibody (6A11) [mFluor Violet 500 SE]
NBP2-53111MFV500 0.1 mL

Mouse Monoclonal Chikungunya Virus Antibody (6A11) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Gnai1 (NM_010305) Mouse Untagged Clone
MC208563 10 µg

Gnai1 (NM_010305) Mouse Untagged Clone

Sign In for Pricing
View Details
Benzthiazide 500mg
A17355-500 500 mg

Benzthiazide 500mg

Sign In for Pricing
View Details
Bonzo (CXCR6) Rabbit Polyclonal Antibody
TA306016 100 µg

Bonzo (CXCR6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nucleoside Diphosphate Kinase, Recombinant, Saccharomyces cerevisiae, aa1-153, His-Tag, Myc-Tag
585615-01 20 µg

Nucleoside Diphosphate Kinase, Recombinant, Saccharomyces cerevisiae, aa1-153, His-Tag, Myc-Tag

Sign In for Pricing
View Details