Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEZ6 Peptide - C-terminal region

SEZ6 Peptide - C-terminal region

Product Specifications

UniProt

Q53EL9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEZ6 Rabbit Polyclonal Antibody (orb586424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849191

Preservative

Lyophilized powder

AA Sequence

RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epac1/RAPGEF3 Rabbit Polyclonal Antibody (APC)
orb2603826 100 µg

Epac1/RAPGEF3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CC85C, NT (CCDC85C, Coiled-coil domain-containing protein 85C) (MaxLight 550) discontinued
033267-ML550 100 µL

CC85C, NT (CCDC85C, Coiled-coil domain-containing protein 85C) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human Anti-Herpes Simplex Virus 2, HSV-2 ELISA KIT
ED0236Hu-01 96 Well

Human Anti-Herpes Simplex Virus 2, HSV-2 ELISA KIT

Sign In for Pricing
View Details
Human Anti-Herpes Simplex Virus 2, HSV-2 ELISA KIT
ED0236Hu-02 5x 96 Tests

Human Anti-Herpes Simplex Virus 2, HSV-2 ELISA KIT

Sign In for Pricing
View Details
Human Anti-Herpes Simplex Virus 2, HSV-2 ELISA KIT
ED0236Hu-03 10x 96 Tests

Human Anti-Herpes Simplex Virus 2, HSV-2 ELISA KIT

Sign In for Pricing
View Details
C5orf35 Rabbit pAb, Pacific Blue conjugated
orb2853346 100 µL

C5orf35 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details