Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEZ6 Peptide - C-terminal region

SEZ6 Peptide - C-terminal region

Product Specifications

UniProt

Q53EL9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEZ6 Rabbit Polyclonal Antibody (orb586424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849191

Preservative

Lyophilized powder

AA Sequence

RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 14 Antibody (KRT14/4131) [DyLight 488]
NBP3-20723G 0.1 mL

Mouse Monoclonal Cytokeratin 14 Antibody (KRT14/4131) [DyLight 488]

Sign In for Pricing
View Details
Recombinant Human VIM/Vimentin Protein, C-His
orb2834301-01 20 µg

Recombinant Human VIM/Vimentin Protein, C-His

Sign In for Pricing
View Details
Recombinant Human VIM/Vimentin Protein, C-His
orb2834301-02 50 µg

Recombinant Human VIM/Vimentin Protein, C-His

Sign In for Pricing
View Details
Recombinant Human VIM/Vimentin Protein, C-His
orb2834301-03 100 µg

Recombinant Human VIM/Vimentin Protein, C-His

Sign In for Pricing
View Details
Human Protein CREG2 (CREG2) ELISA Kit
abx508649 96 Tests

Human Protein CREG2 (CREG2) ELISA Kit

Sign In for Pricing
View Details
HLA-G (8C2) Monoclonal Antibody
bsm-51418M 100 µL

HLA-G (8C2) Monoclonal Antibody

Sign In for Pricing
View Details