Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGPL1 Peptide - C-terminal region

SGPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13811, KIAA1252, SPL

UniProt

O95470

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGPL1 Rabbit Polyclonal Antibody (orb586425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003892

Preservative

Lyophilized powder

AA Sequence

IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Otubain-2 Antibody (OTI11B3) [Alexa Fluor 350]
NBP2-73172AF350 0.1 mL

Mouse Monoclonal Otubain-2 Antibody (OTI11B3) [Alexa Fluor 350]

Sign In for Pricing
View Details
1-Phenyl-4-piperidinamine
158547 5 g

1-Phenyl-4-piperidinamine

Sign In for Pricing
View Details
2- (Cyclohexyloxy) isonicotinonitrile
OR61211-01 1 g

2- (Cyclohexyloxy) isonicotinonitrile

Sign In for Pricing
View Details
2- (Cyclohexyloxy) isonicotinonitrile
OR61211-02 5 g

2- (Cyclohexyloxy) isonicotinonitrile

Sign In for Pricing
View Details
Chiller, DuraChill CA, 1/3HP (1.4kW), Turbine Pump, 1/3HP, 120V, 60Hz
CA03A1T1-41AA1N 1 Each

Chiller, DuraChill CA, 1/3HP (1.4kW), Turbine Pump, 1/3HP, 120V, 60Hz

Sign In for Pricing
View Details
MKI67 Antibody
orb534748-01 20 µg

MKI67 Antibody

Sign In for Pricing
View Details