Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGPL1 Peptide - C-terminal region

SGPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13811, KIAA1252, SPL

UniProt

O95470

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGPL1 Rabbit Polyclonal Antibody (orb586425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003892

Preservative

Lyophilized powder

AA Sequence

IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C1q Binding Protein (C1QBP) Antibody
abx001547-01 60 µL

Complement C1q Binding Protein (C1QBP) Antibody

Sign In for Pricing
View Details
Complement C1q Binding Protein (C1QBP) Antibody
abx001547-02 120 µL

Complement C1q Binding Protein (C1QBP) Antibody

Sign In for Pricing
View Details
Complement C1q Binding Protein (C1QBP) Antibody
abx001547-03 200 µL

Complement C1q Binding Protein (C1QBP) Antibody

Sign In for Pricing
View Details
Recombinant Clostridium Phytofermentans rplB Protein (aa 1-281)
VAng-Lsx01408-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Phytofermentans rplB Protein (aa 1-281)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Signal transduction histidine-protein kinase ArlS (arlS), partial
MBS7088574 Inquire

Recombinant Staphylococcus aureus Signal transduction histidine-protein kinase ArlS (arlS), partial

Sign In for Pricing
View Details
Rabbit Anti-Pig IgG (H&L) Antibody (PE)
orb1878836-01 100 µL

Rabbit Anti-Pig IgG (H&L) Antibody (PE)

Sign In for Pricing
View Details