Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STARD7 Peptide - N-terminal region

STARD7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GTT1

UniProt

Q9NQZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STARD7 Rabbit Polyclonal Antibody (orb586426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064536

Preservative

Lyophilized powder

AA Sequence

SINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Activin Receptor Type IIB (ACVR2B) (N-term) Rabbit Polyclonal Antibody
AP13714PU-N 400 µL

Activin Receptor Type IIB (ACVR2B) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPANXN3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]
TA809110AM 100 µL

SPANXN3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details
Floor Type Low Speed Refrigerated Centrifuge BCFLR-202
BCFLR-202 1 Unit

Floor Type Low Speed Refrigerated Centrifuge BCFLR-202

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS805570 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
GAD65 Recombinant Chimeric Antibody Antibody
HA610232 100 µg

GAD65 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Recombinant Mouse REG2/REG-2 Protein (Fc Tag)
PKSM040340 100 µg

Recombinant Mouse REG2/REG-2 Protein (Fc Tag)

Sign In for Pricing
View Details