Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR160 Peptide - N-terminal region

GPR160 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPCR1, GPCR150

UniProt

Q9UJ42

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR160 Rabbit Polyclonal Antibody (orb586438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055188

Preservative

Lyophilized powder

AA Sequence

ILTLGMRRKNTCQNFMEYFCISLAFVDLLLLVNISIILYFRDFVLLSIRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Glutathione Reductase Antibody
NBP2-16684 0.1 mL

Rabbit Polyclonal Glutathione Reductase Antibody

Sign In for Pricing
View Details
DGCR2 (NM_001173534) Human Over-expression Lysate
LC433199 20 µg

DGCR2 (NM_001173534) Human Over-expression Lysate

Sign In for Pricing
View Details
KLHL24 AAV Vector (Mouse) (CMV)
25788104 1 µg

KLHL24 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
DYT13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
18783111 3x 1.0 µg

DYT13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-Human LUM/Lumican Antibody (RB130)
HW597013-01 50 µg

Anti-Human LUM/Lumican Antibody (RB130)

Sign In for Pricing
View Details
Anti-Human LUM/Lumican Antibody (RB130)
HW597013-02 100 µg

Anti-Human LUM/Lumican Antibody (RB130)

Sign In for Pricing
View Details