Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINPP1 Peptide - C-terminal region

MINPP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp564L2016, HIPER1, MINPP2, MIPP

UniProt

Q9UNW1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MINPP1 Rabbit Polyclonal Antibody (orb586443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004888

Preservative

Lyophilized powder

AA Sequence

VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF2 (B-12) : m-IgG1 BP-HRP Bundle
sc-543022 1 Kit

NF2 (B-12) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Myo3b AAV siRNA Pooled Vector
31293166 1.0 µg

Myo3b AAV siRNA Pooled Vector

Sign In for Pricing
View Details
4930550L24Rik (NM_023774) Mouse Untagged Clone
MC211617 10 µg

4930550L24Rik (NM_023774) Mouse Untagged Clone

Sign In for Pricing
View Details
PFKM Blocking Peptide
MBS9626711-01 1 mg

PFKM Blocking Peptide

Sign In for Pricing
View Details
PFKM Blocking Peptide
MBS9626711-02 5x 1 mg

PFKM Blocking Peptide

Sign In for Pricing
View Details
PPTC7 (NM_139283) Human Tagged ORF Clone Lentiviral Particle
RC217495L3V 200 µL

PPTC7 (NM_139283) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details